PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf03419g13003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 139aa    MW: 16304.7 Da    PI: 8.7548
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf03419g13003.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.53.9e-1554110561
                               CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                    bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                               ++ rrk +NRe+ArrsR RKk+ +++L++ v++L+ eN++Lk++l   + +++  +s
  Niben101Scf03419g13003.1  54 RKRRRKVSNRESARRSRFRKKKHLDNLTDQVDQLKIENRELKNRLYVATHQCQVAQS 110
                               6789*****************************************999999986555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-1150114IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.7E-1152106No hitNo description
PROSITE profilePS5021711.0245298IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.0E-1154106No hitNo description
PfamPF001707.8E-1254106IPR004827Basic-leucine zipper domain
CDDcd147024.33E-1655106No hitNo description
PROSITE patternPS0003605772IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MMFDEPVHYH LPVLEDVLSP SDIHEILSFL QTELPVQSTS GSETTRSVFT VEERKRRRKV  60
SNRESARRSR FRKKKHLDNL TDQVDQLKIE NRELKNRLYV ATHQCQVAQS ETDRLILESI  120
VLQQKLAGLC QILHPMQLQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15357RKRRR
25674RRKVSNRESARRSRFRKKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010320294.12e-60PREDICTED: basic leucine zipper 43
TrEMBLM1A1G04e-68M1A1G0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000125751e-67(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28202251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49760.12e-25basic leucine-zipper 5